- VN1R4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86869
- V1RL4
- VN1R4
- This antibody was developed against Recombinant Protein corresponding to amino acids: TGKWNYTNIT VNEDLGYCSG GGNNKIAQTL RAMLL
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- 0.1 ml (also 25ul)
- Rabbit
- vomeronasal 1 receptor 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Polyclonal
Sequence
TGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLL
Specifications/Features
Available conjugates: Unconjugated